Package: scMultiSim 1.3.0
scMultiSim: Simulation of Multi-Modality Single Cell Data Guided By Gene Regulatory Networks and Cell-Cell Interactions
scMultiSim simulates paired single cell RNA-seq, single cell ATAC-seq and RNA velocity data, while incorporating mechanisms of gene regulatory networks, chromatin accessibility and cell-cell interactions. It allows users to tune various parameters controlling the amount of each biological factor, variation of gene-expression levels, the influence of chromatin accessibility on RNA sequence data, and so on. It can be used to benchmark various computational methods for single cell multi-omics data, and to assist in experimental design of wet-lab experiments.
Authors:
scMultiSim_1.3.0.tar.gz
scMultiSim_1.3.0.zip(r-4.5)scMultiSim_1.3.0.zip(r-4.4)
scMultiSim_1.3.0.tgz(r-4.5-any)scMultiSim_1.3.0.tgz(r-4.4-any)
scMultiSim_1.3.0.tar.gz(r-4.5-noble)scMultiSim_1.3.0.tar.gz(r-4.4-noble)
scMultiSim_1.3.0.tgz(r-4.4-emscripten)
scMultiSim.pdf |scMultiSim.html✨
scMultiSim/json (API)
NEWS
# Install 'scMultiSim' in R: |
install.packages('scMultiSim', repos = c('https://bioc.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/zhanglabgt/scmultisim/issues
Pkgdown site:https://zhanglabgt.github.io
- GRN_params_100 - 100_gene_GRN is a matrix of GRN params consisting of 100 genes where: # - column 1 is the target gene ID, # - column 2 is the gene ID which acts as a transcription factor for the target (regulated) gene # - column 3 is the effect of the column 2 gene ID on the column 1 gene ID
- GRN_params_1139 - GRN_params_1139 is a matrix of GRN params consisting of 1139 genes where: # - column 1 is the target gene ID, # - column 2 is the gene ID which acts as a transcription factor for the target (regulated) gene # - column 3 is the effect of the column 2 gene ID on the column 1 gene ID
- dens_nonzero - This is the density function of log(x+1), where x is the non-zero values for ATAC-SEQ data
On BioConductor:scMultiSim-1.3.0(bioc 3.21)scMultiSim-1.2.0(bioc 3.20)
singlecelltranscriptomicsgeneexpressionsequencingexperimentaldesign
Last updated 5 months agofrom:2e6a4fcebc. Checks:1 OK, 6 NOTE. Indexed: yes.
Target | Result | Latest binary |
---|---|---|
Doc / Vignettes | OK | Mar 18 2025 |
R-4.5-win | NOTE | Mar 18 2025 |
R-4.5-mac | NOTE | Mar 18 2025 |
R-4.5-linux | NOTE | Mar 18 2025 |
R-4.4-win | NOTE | Mar 18 2025 |
R-4.4-mac | NOTE | Mar 18 2025 |
R-4.4-linux | NOTE | Mar 18 2025 |
Exports:add_expr_noiseadd_outlierscci_cell_type_paramsdivide_batchesgen_cluttergene_corr_ccigene_corr_regulatorGet_1region_ATAC_correlationGet_ATAC_correlationPhyla1Phyla3Phyla5plot_cell_locplot_gene_module_cor_heatmapplot_gridplot_grnplot_phylaplot_rna_velocityplot_tsnerun_shinyscmultisim_helpsim_examplesim_example_spatialsim_true_countsTrue2ObservedATACTrue2ObservedCounts
Dependencies:abindapeaskpassassertthatBHBiobaseBiocGenericsBiocParallelbitopscaToolscliclusterGenerationcodacodetoolscolorspacecombinatcommonmarkcpp11crayoncurlDelayedArrayDEoptimdigestdoParalleldplyrexpmfansifarverfastmatchforeachformatRfutile.loggerfutile.optionsgenericsGenomeInfoDbGenomeInfoDbDataGenomicRangesggplot2gluegplotsgtablegtoolshttrigraphIRangesisobanditeratorsjsonliteKernelKnnKernSmoothlabelinglambda.rlatticelifecyclemagrittrmapsmarkdownMASSMatrixMatrixGenericsmatrixStatsmgcvmimemnormtmunsellnlmenumDerivopenssloptimParallelphangornphytoolspillarpkgconfigquadprogR6RColorBrewerRcppRcppArmadillorlangRtsneS4ArraysS4Vectorsscalesscatterplot3dsnowSparseArraySummarizedExperimentsystibbletidyselectUCSC.utilsutf8vctrsviridisLitewithrxfunXVectorzeallot
Getting Started
Rendered fromworkflow.Rmd
usingknitr::knitr
on Mar 18 2025.Last update: 2024-09-02
Started: 2024-08-29
Simulating Multimodal Single-cell Datasets
Rendered frombasics.Rmd
usingknitr::knitr
on Mar 18 2025.Last update: 2024-09-02
Started: 2023-05-18
Simulating Spatial Cell-Cell Interactions
Rendered fromspatialCCI.Rmd
usingknitr::knitr
on Mar 18 2025.Last update: 2024-09-26
Started: 2024-09-26
Parameter Guide
Rendered fromoptions.Rmd
usingknitr::knitr
on Mar 18 2025.Last update: 2024-09-02
Started: 2024-08-29