Package: pfamAnalyzeR 1.7.0
pfamAnalyzeR: Identification of domain isotypes in pfam data
Protein domains is one of the most import annoation of proteins we have with the Pfam database/tool being (by far) the most used tool. This R package enables the user to read the pfam prediction from both webserver and stand-alone runs into R. We have recently shown most human protein domains exist as multiple distinct variants termed domain isotypes. Different domain isotypes are used in a cell, tissue, and disease-specific manner. Accordingly, we find that domain isotypes, compared to each other, modulate, or abolish the functionality of a protein domain. This R package enables the identification and classification of such domain isotypes from Pfam data.
Authors:
pfamAnalyzeR_1.7.0.tar.gz
pfamAnalyzeR_1.7.0.zip(r-4.5)pfamAnalyzeR_1.7.0.zip(r-4.4)pfamAnalyzeR_1.7.0.zip(r-4.3)
pfamAnalyzeR_1.7.0.tgz(r-4.4-any)pfamAnalyzeR_1.7.0.tgz(r-4.3-any)
pfamAnalyzeR_1.7.0.tar.gz(r-4.5-noble)pfamAnalyzeR_1.7.0.tar.gz(r-4.4-noble)
pfamAnalyzeR_1.7.0.tgz(r-4.4-emscripten)pfamAnalyzeR_1.7.0.tgz(r-4.3-emscripten)
pfamAnalyzeR.pdf |pfamAnalyzeR.html✨
pfamAnalyzeR/json (API)
NEWS
# Install 'pfamAnalyzeR' in R: |
install.packages('pfamAnalyzeR', repos = c('https://bioc.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/kvittingseerup/pfamanalyzer/issues
On BioConductor:pfamAnalyzeR-1.7.0(bioc 3.21)pfamAnalyzeR-1.6.0(bioc 3.20)
alternativesplicingtranscriptomevariantbiomedicalinformaticsfunctionalgenomicssystemsbiologyannotationfunctionalpredictiongenepredictiondataimport
Last updated 23 days agofrom:f426e744d5. Checks:OK: 1 NOTE: 6. Indexed: yes.
Target | Result | Date |
---|---|---|
Doc / Vignettes | OK | Oct 31 2024 |
R-4.5-win | NOTE | Oct 31 2024 |
R-4.5-linux | NOTE | Oct 31 2024 |
R-4.4-win | NOTE | Oct 31 2024 |
R-4.4-mac | NOTE | Oct 31 2024 |
R-4.3-win | NOTE | Oct 31 2024 |
R-4.3-mac | NOTE | Oct 31 2024 |
Exports:analyse_pfam_isotypesaugment_pfampfamAnalyzeRread_pfam
Dependencies:bitbit64clicliprcpp11crayondplyrfansigenericsgluehmslifecyclemagrittrpillarpkgconfigprettyunitsprogressR6readrrlangstringistringrtibbletidyselecttzdbutf8vctrsvroomwithr
Readme and manuals
Help Manual
Help page | Topics |
---|---|
Determine domain isotype | analyse_pfam_isotypes |
Augment pfam domains with truncation/indel calculations | augment_pfam |
Read in and analyze pfam domains isotypes | pfamAnalyzeR |
Read Pfam file into R | read_pfam |