Package: pfamAnalyzeR 1.7.0

Kristoffer Vitting-Seerup

pfamAnalyzeR: Identification of domain isotypes in pfam data

Protein domains is one of the most import annoation of proteins we have with the Pfam database/tool being (by far) the most used tool. This R package enables the user to read the pfam prediction from both webserver and stand-alone runs into R. We have recently shown most human protein domains exist as multiple distinct variants termed domain isotypes. Different domain isotypes are used in a cell, tissue, and disease-specific manner. Accordingly, we find that domain isotypes, compared to each other, modulate, or abolish the functionality of a protein domain. This R package enables the identification and classification of such domain isotypes from Pfam data.

Authors:Kristoffer Vitting-Seerup [cre, aut]

pfamAnalyzeR_1.7.0.tar.gz
pfamAnalyzeR_1.7.0.zip(r-4.5)pfamAnalyzeR_1.7.0.zip(r-4.4)pfamAnalyzeR_1.7.0.zip(r-4.3)
pfamAnalyzeR_1.7.0.tgz(r-4.4-any)pfamAnalyzeR_1.7.0.tgz(r-4.3-any)
pfamAnalyzeR_1.7.0.tar.gz(r-4.5-noble)pfamAnalyzeR_1.7.0.tar.gz(r-4.4-noble)
pfamAnalyzeR_1.7.0.tgz(r-4.4-emscripten)pfamAnalyzeR_1.7.0.tgz(r-4.3-emscripten)
pfamAnalyzeR.pdf |pfamAnalyzeR.html
pfamAnalyzeR/json (API)
NEWS

# Install 'pfamAnalyzeR' in R:
install.packages('pfamAnalyzeR', repos = c('https://bioc.r-universe.dev', 'https://cloud.r-project.org'))

Peer review:

Bug tracker:https://github.com/kvittingseerup/pfamanalyzer/issues

On BioConductor:pfamAnalyzeR-1.7.0(bioc 3.21)pfamAnalyzeR-1.6.0(bioc 3.20)

alternativesplicingtranscriptomevariantbiomedicalinformaticsfunctionalgenomicssystemsbiologyannotationfunctionalpredictiongenepredictiondataimport

3.78 score 1 stars 1 packages 1 scripts 450 downloads 4 exports 29 dependencies

Last updated 2 months agofrom:f426e744d5. Checks:OK: 1 NOTE: 6. Indexed: yes.

TargetResultDate
Doc / VignettesOKNov 30 2024
R-4.5-winNOTENov 30 2024
R-4.5-linuxNOTENov 30 2024
R-4.4-winNOTENov 30 2024
R-4.4-macNOTENov 30 2024
R-4.3-winNOTENov 30 2024
R-4.3-macNOTENov 30 2024

Exports:analyse_pfam_isotypesaugment_pfampfamAnalyzeRread_pfam

Dependencies:bitbit64clicliprcpp11crayondplyrfansigenericsgluehmslifecyclemagrittrpillarpkgconfigprettyunitsprogressR6readrrlangstringistringrtibbletidyselecttzdbutf8vctrsvroomwithr

Vignette for pfamAnalyzeR

Rendered frompfamAnalyzeR.Rmdusingknitr::rmarkdownon Nov 30 2024.

Last update: 2023-05-25
Started: 2022-08-12