Package: pfamAnalyzeR 1.13.0
pfamAnalyzeR: Identification of domain isotypes in pfam data
Protein domains is one of the most import annoation of proteins we have with the Pfam database/tool being (by far) the most used tool. This R package enables the user to read the pfam prediction from both webserver and stand-alone runs into R. We have recently shown most human protein domains exist as multiple distinct variants termed domain isotypes. Different domain isotypes are used in a cell, tissue, and disease-specific manner. Accordingly, we find that domain isotypes, compared to each other, modulate, or abolish the functionality of a protein domain. This R package enables the identification and classification of such domain isotypes from Pfam data.
Authors:
pfamAnalyzeR_1.13.0.tar.gz
pfamAnalyzeR_1.13.0.zip(r-4.7)pfamAnalyzeR_1.13.0.zip(r-4.6)pfamAnalyzeR_1.13.0.zip(r-4.5)
pfamAnalyzeR_1.13.0.tgz(r-4.6-any)pfamAnalyzeR_1.13.0.tgz(r-4.5-any)
pfamAnalyzeR_1.13.0.tar.gz(r-4.7-any)pfamAnalyzeR_1.13.0.tar.gz(r-4.6-any)
pfamAnalyzeR_1.13.0.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
pfamAnalyzeR/json (API)
| # Install 'pfamAnalyzeR' in R: |
| install.packages('pfamAnalyzeR', repos = c('https://bioc.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/kvittingseerup/pfamanalyzer/issues
On BioConductor:pfamAnalyzeR-1.13.0(bioc 3.24)pfamAnalyzeR-1.12.0(bioc 3.23)
alternativesplicingtranscriptomevariantbiomedicalinformaticsfunctionalgenomicssystemsbiologyannotationfunctionalpredictiongenepredictiondataimport
Last updated from:bdce5208aa. Checks:1 WARNING, 7 NOTE, 2 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| bioc-checks | WARNING | 142 | ||
| linux-devel-x86_64 | NOTE | 232 | ||
| source / vignettes | OK | 174 | ||
| linux-release-x86_64 | NOTE | 202 | ||
| macos-release-arm64 | NOTE | 84 | ||
| macos-oldrel-arm64 | NOTE | 71 | ||
| windows-devel | NOTE | 67 | ||
| windows-release | NOTE | 121 | ||
| windows-oldrel | NOTE | 93 | ||
| wasm-release | OK | 99 |
Exports:analyse_pfam_isotypesaugment_pfampfamAnalyzeRread_pfam
Dependencies:bitbit64clicliprcpp11crayondplyrgenericsgluehmslifecyclemagrittrpillarpkgconfigprettyunitsprogressR6readrrlangstringistringrtibbletidyselecttzdbutf8vctrsvroomwithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Determine domain isotype | analyse_pfam_isotypes |
| Augment pfam domains with truncation/indel calculations | augment_pfam |
| Read in and analyze pfam domains isotypes | pfamAnalyzeR |
| Read Pfam file into R | read_pfam |
