Package: immunogenViewer 1.1.0
immunogenViewer: Visualization and evaluation of protein immunogens
Plots protein properties and visualizes position of peptide immunogens within protein sequence. Allows evaluation of immunogens based on structural and functional annotations to infer suitability for antibody-based methods aiming to detect native proteins.
Authors:
immunogenViewer_1.1.0.tar.gz
immunogenViewer_1.1.0.zip(r-4.5)immunogenViewer_1.1.0.zip(r-4.4)immunogenViewer_1.1.0.zip(r-4.3)
immunogenViewer_0.99.4.tgz(r-4.4-any)immunogenViewer_0.99.4.tgz(r-4.3-any)
immunogenViewer_1.1.0.tar.gz(r-4.5-noble)immunogenViewer_1.1.0.tar.gz(r-4.4-noble)
immunogenViewer_1.1.0.tgz(r-4.4-emscripten)immunogenViewer_1.1.0.tgz(r-4.3-emscripten)
immunogenViewer.pdf |immunogenViewer.html✨
immunogenViewer/json (API)
# Install 'immunogenViewer' in R: |
install.packages('immunogenViewer', repos = c('https://bioc.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/kathiwaury/immunogenviewer/issues
On BioConductor:immunogenViewer-0.99.5(bioc 3.20)
featureextractionproteomicssoftwarevisualization
Last updated 8 days agofrom:a57d054f08. Checks:OK: 1 NOTE: 5 ERROR: 1. Indexed: yes.
Target | Result | Date |
---|---|---|
Doc / Vignettes | OK | Oct 30 2024 |
R-4.5-win | NOTE | Oct 31 2024 |
R-4.5-linux | NOTE | Oct 30 2024 |
R-4.4-win | NOTE | Oct 31 2024 |
R-4.4-mac | ERROR | Oct 07 2024 |
R-4.3-win | NOTE | Oct 31 2024 |
R-4.3-mac | NOTE | Aug 08 2024 |
Exports:addImmunogenevaluateImmunogengetProteinFeaturesplotImmunogenplotProteinremoveImmunogenrenameImmunogen
Dependencies:AnnotationDbiaskpassBiobaseBiocBaseUtilsBiocFileCacheBiocGenericsBiostringsbitbit64blobcachemclicolorspacecpp11crayoncurlDBIdbplyrdigestdplyrfansifarverfastmapfilelockgenericsGenomeInfoDbGenomeInfoDbDataggplot2gluegtablehmshttpcachehttrIRangesisobandjsonliteKEGGRESTlabelinglatticelifecyclemagrittrMASSMatrixmemoisemgcvmimemunsellnlmeopensslpatchworkpillarpkgconfigplogrpngprettyunitsprogresspurrrR6RColorBrewerrjsonconsrlangRSQLiteS4VectorsscalesstringistringrsystibbletidyrtidyselectUCSC.utilsUniProt.wsutf8vctrsviridisLitewithrXVectorzlibbioc
Readme and manuals
Help Manual
Help page | Topics |
---|---|
Add an immunogen to the Protein DataFrame | addImmunogen |
Create a summary DataFrame of the structural and functional properties of an immunogen | evaluateImmunogen |
Retrieve structural and functional features to create a protein DataFrame | getProteinFeatures |
Plot protein features of one immunogen region | plotImmunogen |
Plot protein features with immunogens highlighted | plotProtein |
Remove an existing immunogen | removeImmunogen |
Rename an existing immunogen | renameImmunogen |