Package: PPInfer 1.33.0

Dongmin Jung

PPInfer: Inferring functionally related proteins using protein interaction networks

Interactions between proteins occur in many, if not most, biological processes. Most proteins perform their functions in networks associated with other proteins and other biomolecules. This fact has motivated the development of a variety of experimental methods for the identification of protein interactions. This variety has in turn ushered in the development of numerous different computational approaches for modeling and predicting protein interactions. Sometimes an experiment is aimed at identifying proteins closely related to some interesting proteins. A network based statistical learning method is used to infer the putative functions of proteins from the known functions of its neighboring proteins on a PPI network. This package identifies such proteins often involved in the same or similar biological functions.

Authors:Dongmin Jung, Xijin Ge

PPInfer_1.33.0.tar.gz
PPInfer_1.33.0.zip(r-4.5)PPInfer_1.33.0.zip(r-4.4)PPInfer_1.33.0.zip(r-4.3)
PPInfer_1.33.0.tgz(r-4.4-any)PPInfer_1.33.0.tgz(r-4.3-any)
PPInfer_1.33.0.tar.gz(r-4.5-noble)PPInfer_1.33.0.tar.gz(r-4.4-noble)
PPInfer_1.33.0.tgz(r-4.4-emscripten)PPInfer_1.33.0.tgz(r-4.3-emscripten)
PPInfer.pdf |PPInfer.html
PPInfer/json (API)
NEWS

# Install 'PPInfer' in R:
install.packages('PPInfer', repos = c('https://bioc.r-universe.dev', 'https://cloud.r-project.org'))

Peer review:

On BioConductor:PPInfer-1.33.0(bioc 3.21)PPInfer-1.32.0(bioc 3.20)

This package does not link to any Github/Gitlab/R-forge repository. No issue tracker or development information is available.

softwarestatisticalmethodnetworkgraphandnetworkgenesetenrichmentnetworkenrichmentpathways

4.48 score 1 packages 4 scripts 440 downloads 10 exports 107 dependencies

Last updated 2 months agofrom:d4d24bc527. Checks:OK: 3 NOTE: 4. Indexed: yes.

TargetResultDate
Doc / VignettesOKNov 30 2024
R-4.5-winOKNov 30 2024
R-4.5-linuxOKNov 30 2024
R-4.4-winNOTENov 30 2024
R-4.4-macNOTENov 30 2024
R-4.3-winNOTENov 30 2024
R-4.3-macNOTENov 30 2024

Exports:enrich.netGSEA.barplotnet.infernet.infer.STnet.kernelORAORA.barplotppi.infer.humanppi.infer.mouseself.train.kernel

Dependencies:AnnotationDbiaskpassBHBiobaseBiocFileCacheBiocGenericsBiocParallelbiomaRtBiostringsbitbit64bitopsblobcachemcaToolschronclicodetoolscolorspacecowplotcpp11crayoncurldata.tableDBIdbplyrdigestdplyrfansifarverfastmapfastmatchfgseafilelockformatRfutile.loggerfutile.optionsgenericsGenomeInfoDbGenomeInfoDbDataggplot2gluegplotsgraphgsubfngtablegtoolshashhmshttrhttr2igraphIRangesisobandjsonliteKEGGRESTkernlabKernSmoothlabelinglambda.rlatticelifecyclemagrittrMASSMatrixmemoisemgcvmimemunsellnlmeopensslpillarpkgconfigplogrplotrixplyrpngprettyunitsprogressprotopurrrR6rappdirsRColorBrewerRcpprlangRSQLiteS4VectorsscalessnowsqldfSTRINGdbstringistringrsystibbletidyrtidyselectUCSC.utilsutf8vctrsviridisLitewithrxml2XVectoryeastExpDatazlibbioc

User manual

Rendered fromPPInfer.Rnwusingutils::Sweaveon Nov 30 2024.

Last update: 2020-02-03
Started: 2017-04-18