| Title: | Prediction of Oligomerization of Coiled Coil Proteins |
|---|---|
| Description: | The package allows for predicting whether a coiled coil sequence (amino acid sequence plus heptad register) is more likely to form a dimer or more likely to form a trimer. Additionally to the prediction itself, a prediction profile is computed which allows for determining the strengths to which the individual residues are indicative for either class. Prediction profiles can also be visualized as curves or heatmaps. |
| Authors: | Ulrich Bodenhofer [aut, cre] |
| Maintainer: | Ulrich Bodenhofer <[email protected]> |
| License: | GPL (>= 2) |
| Version: | 2.41.0 |
| Built: | 2026-05-30 06:58:13 UTC |
| Source: | https://github.com/bioc/procoil |
The package allows for predicting whether a coiled coil sequence (amino acid sequence plus heptad register) is more likely to form a dimer or more likely to form a trimer. Additionally to the prediction itself, a prediction profile is computed which allows for determining the strengths to which the individual residues are indicative for either class. Prediction profiles can also be visualized as curves or heatmaps.
The package defines two S4 classes, CCModel and
CCProfile. The former's purpose is to represent
a coiled coil prediction model. The default model
PrOCoilModel is pre-loaded when the package is loaded.
An alternative model PrOCoilModelBA is also available.
Other models can be loaded with the function
readCCModel. The
predict function is
used to predict the oligomerization of one or more coiled coil
sequences (which consist of a amino acid sequences and heptad
registers aligned to them). The result is stored in a
CCProfile object.
The resulting prediction profile can be visualized with
plot.
Ulrich Bodenhofer
https://github.com/UBod/procoil/
Mahrenholz, C.C., Abfalter, I.G., Bodenhofer, U., Volkmer, R., and Hochreiter, S. (2011) Complex networks govern coiled coil oligomerization - predicting and profiling by means of a machine learning approach. Mol. Cell. Proteomics 10(5):M110.004994. DOI: doi:10.1074/mcp.M110.004994.
## display summary of default model PrOCoilModel ## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## display result GCN4wt ## plot profile plot(GCN4wt) ## predict oligomerization of unknown sequence (Marcoil example) MarcoilEx <- predict(PrOCoilModel, "MGECDQLLVFMITSRVLVLSTLIIMDSRQVYLENLRQFAENLRQNIENVHSFLENLRADLENLRQKFPGKWYSAMPGRHG", "-------------------------------abcdefgabcdefgabcdefgabcdefgabcdefg--------------") ## display result MarcoilEx ## plot profile plot(MarcoilEx)## display summary of default model PrOCoilModel ## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## display result GCN4wt ## plot profile plot(GCN4wt) ## predict oligomerization of unknown sequence (Marcoil example) MarcoilEx <- predict(PrOCoilModel, "MGECDQLLVFMITSRVLVLSTLIIMDSRQVYLENLRQFAENLRQNIENVHSFLENLRADLENLRQKFPGKWYSAMPGRHG", "-------------------------------abcdefgabcdefgabcdefgabcdefgabcdefg--------------") ## display result MarcoilEx ## plot profile plot(MarcoilEx)
S4 class representing a coiled coil prediction model
In principle, objects of this class can be created by calls of
the form new("CCModel"), although it is probably never necessary
to create such an object from scratch - and not advised either.
The default model is stored in
the object PrOCoilModel. An alternative model,
PrOCoilModelBA, that is optimized for balanced accuracy
is available too (see below). Custom models can be loaded
from files using the function readCCModel.
Given a new coiled coil sequence and a model,
the discriminant function of the model is given as
where is a constant offset, denotes the number of
occurrences of pattern in sequence , and
is the weight assigned to pattern .
is the set of all patterns contained in the model.
In the models used in the procoil package, the
weights are computed from a support vector machine. Models can
include kernel normalization or not. The formula above refers to
the variant without kernel normalization. If kernel normalization
is employed, the weights are computed in a different way and the
discriminant function changes to
where is a normalization value depending on the
sample . It is defined as follows:
The procoil package does not consider arbitrary
patterns, but only very specific ones: pairs of amino acids at
fixed register positions with no more than a maximum number
of residues in between. Internally, these patterns are
represented as strings with an amino acid letter on the first
position, then a certain number of wildcards (between 0 and
as noted above), then the second amino acid letter, and
an aligned sequence with the same number of wildcards and letters
‘a’-‘g’ denoting the heptad
register position on the first and last amino acid, e.g.
“N..La..d”. This pattern matches a coiled coil sequence if
the sequence has an ‘N’ (Asparagine) at an ‘a’
position and a ‘L’ (Leucine) at the next ‘d’
position. For instance, the GCN4 wildtype has one occurrence of
this pattern:
MKQLEDKVEELLSKNYHLENEVARLKKLV
abcdefgabcdefgabcdefgabcdefga
N..L
a d
b:Object of class numeric the value
as described above
m:Object of class integer the value
as described above
scaling:Object of class logical
indicating whether the model should employ
kernel normalization
weights:Object of class
matrix storing all pattern weights;
the matrix in this slot is actually consisting of only
one row that contains the weights. The patterns are
stored in column names of the matrix and encoded in
the format described above
signature(object = "CCModel"): see
predict
signature(object = "CCModel"): displays the most
important information stored in the CCModel object
object, such as, kernel parameters and a summary of weights.
signature(object="CCModel"): returns the
weights stored in object as a named numeric vector.
PrOCoilModel
The procoil package provides a default
coiled coil prediction model, PrOCoilModel.
The model was created with the kebabs package
[Palme et al., 2015] using the coiled coil kernel
with , , and kernel normalization on the
BLAST-augmented data set.
It is optimized for standard (unbalanced) accuracy, i.e. it tries to
minimize the probability of misclassifications. Since dimers are more
frequent in the data set, it slightly favors dimers for unknown
sequences.
Note that this is not the original model as described in [Mahrenholz et al., 2011]. The models have been re-trained for version 2.0.0 of the package using a newer snapshot of PDB and newer methods. The original models are still available for download and can still be used if the user wishes to. For detailed instructions, see the package vignette.
PrOCoilModelBA
As mentioned above, the default model PrOCoilModel
slightly favors dimers. This may be undesirable for some
applications. For such cases, an alternative model
PrOCoilModelBA is available that is optimized
for balanced accuracy, i.e. it tries not to favor the larger
class - dimers -, but may therefore prefer trimers in borderline cases.
The overall misclassification probability is slightly higher for
this model than for the default model PrOCoilModel.
The model PrOCoilModelBA was created with PSVM
[Hochreiter and Obermayer, 2006] using
the coiled coil kernel with , ,
, class balancing, and kernel
normalization on the PDB data set (i.e. without BLAST augmentation).
The same applies as for PrOCoilModel: this model has been
re-trained for package version 2.0.0. For detailed instructions how to
use the original models, see the package vignette.
Ulrich Bodenhofer
https://github.com/UBod/procoil/
Mahrenholz, C.C., Abfalter, I.G., Bodenhofer, U., Volkmer, R., and Hochreiter, S. (2011) Complex networks govern coiled coil oligomerization - predicting and profiling by means of a machine learning approach. Mol. Cell. Proteomics 10(5):M110.004994. DOI: doi:10.1074/mcp.M110.004994.
Palme, J., Hochreiter, S., and Bodenhofer, U. (2015) KeBABS: an R package for kernel-based analysis of biological sequences. Bioinformatics 31(15):2574-2576. DOI: doi:10.1093/bioinformatics/btv176.
Hochreiter, S., and Obermayer, K. (2006) Support vector machines for dyadic data. Neural Computation 18:1472-1510. DOI: doi:10.1162/neco.2006.18.6.1472.
showClass("CCModel") ## show summary of default model (optimized for accuracy) PrOCoilModel ## show weight of pattern "N..La..d" weights(PrOCoilModel)["N..La..d"] ## show the 10 patterns that are most indicative for trimers ## (as the weights are sorted in descending order in PrOCoilModel) weights(PrOCoilModel)[1:10] ## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## show summary of alternative model (optimized for balanced accuracy) PrOCoilModelBA ## show weight of pattern "N..La..d" weights(PrOCoilModelBA)["N..La..d"] ## show the 10 patterns that are most indicative for trimers ## (as the weights are sorted in descending order in PrOCoilModelBA) weights(PrOCoilModelBA)[1:10]showClass("CCModel") ## show summary of default model (optimized for accuracy) PrOCoilModel ## show weight of pattern "N..La..d" weights(PrOCoilModel)["N..La..d"] ## show the 10 patterns that are most indicative for trimers ## (as the weights are sorted in descending order in PrOCoilModel) weights(PrOCoilModel)[1:10] ## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## show summary of alternative model (optimized for balanced accuracy) PrOCoilModelBA ## show weight of pattern "N..La..d" weights(PrOCoilModelBA)["N..La..d"] ## show the 10 patterns that are most indicative for trimers ## (as the weights are sorted in descending order in PrOCoilModelBA) weights(PrOCoilModelBA)[1:10]
Functions for reading a coiled coil prediction models
from a file into a CCModel object
and writing a CCModel object to a file.
readCCModel(file) writeCCModel(object, file)readCCModel(file) writeCCModel(object, file)
file |
the name of the file from which |
object |
the |
The procoil package comes with two ready-made models
for oligomerization prediction, PrOCoilModel
and PrOCoilModelBA. In case the user wants to
define custom models or wishes to use previous versions of
the prediction models, the functions readCCModel and
writeCCModel can be used to read/write models
from/to plain text files that can be viewed and also modified.
writeCCModel writes models in the following format:
_b,-1.07262284445085
_m,5
_scaling,1
L...Vd...a,1.63626232200227
R....Eg....e,1.5382098040217
R.Ec.e,1.29025032360792
E..Ve..a,1.22837780239385
...
Correspondingly, readCModel expects the file to conform
to the above format. See CCModel for an
overview of model parameters and an explanation of patterns and
weights.
Upon successful completion, readCCModel returns a
CCModel object. writeCCModel
returns an invisible NULL.
The PrOCoil model is available on
on http://www.bioinf.jku.at/software/procoil/PrOCoilModel_v2.CCModel.
in exactly the format the function readCCModel requires.
Analogously for the alternative model optimized for balanced
accuracy (see CCModel):
http://www.bioinf.jku.at/software/procoil/PrOCoilModelBA_v2.CCModel.
The original models described in [Mahrenholz et al., 2011]
are available on
http://www.bioinf.jku.at/software/procoil/PrOCoilModel_v1.CCModel
and
http://www.bioinf.jku.at/software/procoil/PrOCoilModelBA_v1.CCModel,
respectively. So, by loading one of these files, the original models
can still be used.
Ulrich Bodenhofer
https://github.com/UBod/procoil/
Mahrenholz, C.C., Abfalter, I.G., Bodenhofer, U., Volkmer, R., and Hochreiter, S. (2011) Complex networks govern coiled coil oligomerization - predicting and profiling by means of a machine learning approach. Mol. Cell. Proteomics 10(5):M110.004994. DOI: doi:10.1074/mcp.M110.004994.
## load small example model file for testing purposes ## NOTE: this is an incomplete model that will probably not provide ## meaningful predictions file <- system.file("examples", "testModel.CCModel", package="procoil") testModel <- readCCModel(file) testModel ## Not run: ## read original model from file URL <- "http://www.bioinf.jku.at/software/procoil/PrOCoilModel_v1.CCModel" PrOCoilModelV1 <- readCCModel(URL) ## display summary of example model PrOCoilModelV1 ## display 10 heightes pattern weights weights(PrOCoilModelV1)[1:10] ## End(Not run)## load small example model file for testing purposes ## NOTE: this is an incomplete model that will probably not provide ## meaningful predictions file <- system.file("examples", "testModel.CCModel", package="procoil") testModel <- readCCModel(file) testModel ## Not run: ## read original model from file URL <- "http://www.bioinf.jku.at/software/procoil/PrOCoilModel_v1.CCModel" PrOCoilModelV1 <- readCCModel(URL) ## display summary of example model PrOCoilModelV1 ## display 10 heightes pattern weights weights(PrOCoilModelV1)[1:10] ## End(Not run)
S4 class for representing coiled coil prediction results
In principle, objects of this class can be created by calls of
the form new("CCProfile"), although it is not advised to do so.
Most importantly, the
predict function of
returns its results in objects of this type.
This class extends the class PredictionProfile from
the kebabs package directly and therefore inherits all its slots
and methods. The following slots are defined for CCProfile objects
additionally:
disc:Object of class numeric containing
the discriminant function value(s)
(see CCModel for details)
pred:Object of class factor containing
the final classification(s). Upon a call to
predict,
it is either “trimer” or
“dimer”.
As described in CCModel, the discriminant function
of the coiled coil classifier is essentially a weighted sum of
numbers of occurrences of certain patterns in the sequence under
consideration, i.e. every pattern occurring in the sequence contributes
a certain weight to the discriminant function. Since every such
occurrence is uniquely linked to two specific residues in the
sequence, every amino acid in the sequence contributes a unique weight
to the discriminant function value which is nothing else but half the
sum of weights of matching patterns in which this amino acid is
involved. If we denote the contribution of each position with
, it follows immediately that
where is the length of the sequence . The values
can then be understood as the contributions that
the i-th residue makes to the overall classification of the sequence
, which we call prediction profile. These profiles can
either be visualized as they are without taking the offset
into account or by distributing equally over all residues.
These are the so-called baselines that are included in
CCProfile objects. They are computed as .
signature(x="CCProfile", y="missing"): see
plot
signature(x="CCProfile", y="missing"): if the
CCProfile object x contains the profiles of at least
three sequences, the profiles are visualized as a heatmap.
This method is inherited from the kebabs package; for
details, see
heatmap.
signature(object="CCProfile"):
displays the most important information stored in the
CCProfile object object, such as, the sequences,
kernel parameters, baselines, profiles, and classification results.
The CCProfile class inherits all accessors from the
PredictionProfile class, such as,
sequences,
baselines,
profiles, and
the indexing operator x[i].
Additionally, the procoil package defines the following two methods:
signature(fitted="CCProfile"): for
compatibility with previous versions, a method profile
is available, too. It extracts the profile(s) in the same way as
profiles
signature(object="CCProfile"): extracts
the final classifications. This function returns a factor with
levels “dimer” and “trimer”. If
decision.values=TRUE is specified, a numeric vector is
attached to the result as an attribute "decision.values"
which also contains the discriminant function values.
Ulrich Bodenhofer
https://github.com/UBod/procoil/
Mahrenholz, C.C., Abfalter, I.G., Bodenhofer, U., Volkmer, R., and Hochreiter, S. (2011) Complex networks govern coiled coil oligomerization - predicting and profiling by means of a machine learning approach. Mol. Cell. Proteomics 10(5):M110.004994. DOI: doi:10.1074/mcp.M110.004994.
Palme, J., Hochreiter, S., and Bodenhofer, U. (2015) KeBABS: an R package for kernel-based analysis of biological sequences. Bioinformatics 31(15):2574-2576. DOI: doi:10.1093/bioinformatics/btv176.
CCModel,
plot,
plot,
PredictionProfileAccessors,
showClass("CCProfile") ## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## display summary of result GCN4wt ## show raw prediction profile profile(GCN4wt) ## plot profile plot(GCN4wt) ## define four GCN4 mutations GCN4mSeq <- c("GCN4wt" ="MKQLEDKVEELLSKNYHLENEVARLKKLV", "GCN4_N16Y_L19T"="MKQLEDKVEELLSKYYHTENEVARLKKLV", "GCN4_E22R_K27E"="MKQLEDKVEELLSKNYHLENRVARLEKLV", "GCN4_V23K_K27E"="MKQLEDKVEELLSKNYHLENEKARLEKLV") GCN4mReg <- rep("abcdefgabcdefgabcdefgabcdefga", 4) ## predict oligomerization GCN4mut <- predict(PrOCoilModel, GCN4mSeq, GCN4mReg) ## display summary of result GCN4mut ## display predictions fitted(GCN4mut) ## overlay plot of two profiles plot(GCN4mut[c(1, 2)]) ## show heatmap heatmap(GCN4mut)showClass("CCProfile") ## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## display summary of result GCN4wt ## show raw prediction profile profile(GCN4wt) ## plot profile plot(GCN4wt) ## define four GCN4 mutations GCN4mSeq <- c("GCN4wt" ="MKQLEDKVEELLSKNYHLENEVARLKKLV", "GCN4_N16Y_L19T"="MKQLEDKVEELLSKYYHTENEVARLKKLV", "GCN4_E22R_K27E"="MKQLEDKVEELLSKNYHLENRVARLEKLV", "GCN4_V23K_K27E"="MKQLEDKVEELLSKNYHLENEKARLEKLV") GCN4mReg <- rep("abcdefgabcdefgabcdefgabcdefga", 4) ## predict oligomerization GCN4mut <- predict(PrOCoilModel, GCN4mSeq, GCN4mReg) ## display summary of result GCN4mut ## display predictions fitted(GCN4mut) ## overlay plot of two profiles plot(GCN4mut[c(1, 2)]) ## show heatmap heatmap(GCN4mut)
Functions for plotting prediction profiles
## S4 method for signature 'CCProfile,missing' plot(x, col=c("red", "blue"), standardize=TRUE, shades=NULL, legend="default", legendPos="topright", xlab="", ylab="weight", lwd.profile=1, lwd.axis=1, las=1, heptads=TRUE, annotate=TRUE, ...)## S4 method for signature 'CCProfile,missing' plot(x, col=c("red", "blue"), standardize=TRUE, shades=NULL, legend="default", legendPos="topright", xlab="", ylab="weight", lwd.profile=1, lwd.axis=1, las=1, heptads=TRUE, annotate=TRUE, ...)
x |
Object of class |
col |
Character string containing the name(s) of the color(s) in which the profile(s) should be plotted. |
standardize |
If |
shades |
Vector of at least two color specifications (default:
NULL). If not NULL, the background area above and below the base
line |
legend |
A character string containing the legend/description of
the profile. If |
legendPos |
position specification for legend (if |
xlab |
label of horizontal axis, empty by default. |
ylab |
label of vertical axis, defaults to “weight”. |
lwd.profile |
profile line width as described for
parameter |
lwd.axis |
axis line width as described for
parameter |
las |
see |
heptads |
if |
annotate |
if |
... |
all other arguments are passed to the
|
The plot function displays a prediction profile as a step
function over the sequence with the steps connected by vertical lines.
The sequence and the heptad register are visualized below and above
the profile, respectively. The baseline value and the light
gray line has the following meaning: It is obvious that we can rewrite
as
so the discriminant function value can be understood
as the sum of values , i.e.
the area between the constant value and the prediction
profile. If the area above the light gray line is greater than
the area below the light gray line, the sequence is predicted as
trimer, otherwise as dimer.
If plot is called for a CCProfile object
that contains profiles of two sequences, the two profiles are plotted
together to facilitate a comparison of profiles (e.g. wild type
sequences versus mutants). Although the plot function tolerates
profiles/sequences with different lengths and/or unaligned heptad
registers, it is obvious that the superimposition of profiles of
two unaligned, unrelated sequences makes little sense.
The plot functions gives an error if is called for a
CCProfile object that contains profiles of
three or more sequences.
The given function is only a wrapper around the
plot function provided
by the kebabs package. The only difference is that heptad
seperators (argument heptads) and the heptad annotation
(argument annotate) are displayed by default.
Moreover, presently, no legend is displayed by default if a
single profile is plotted for an unnamed sequence.
This function does not return any value.
Ulrich Bodenhofer
https://github.com/UBod/procoil/
Mahrenholz, C.C., Abfalter, I.G., Bodenhofer, U., Volkmer, R., and Hochreiter, S. (2011) Complex networks govern coiled coil oligomerization - predicting and profiling by means of a machine learning approach. Mol. Cell. Proteomics 10(5):M110.004994. DOI: doi:10.1074/mcp.M110.004994.
Palme, J., Hochreiter, S., and Bodenhofer, U. (2015) KeBABS: an R package for kernel-based analysis of biological sequences. Bioinformatics 31(15):2574-2576. DOI: doi:10.1093/bioinformatics/btv176.
## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## plot profile plot(GCN4wt) ## define two GCN4 mutations GCN4mSeq <- c("GCN4wt" ="MKQLEDKVEELLSKNYHLENEVARLKKLV", "GCN4_N16I_L19N"="MKQLEDKVEELLSKIYHNENEVARLKKLV") GCN4mReg <- rep("abcdefgabcdefgabcdefgabcdefga", 2) ## predict oligomerization GCN4mut <- predict(PrOCoilModel, GCN4mSeq, GCN4mReg) ## overlay plot of the two profiles plot(GCN4mut)## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## plot profile plot(GCN4wt) ## define two GCN4 mutations GCN4mSeq <- c("GCN4wt" ="MKQLEDKVEELLSKNYHLENEVARLKKLV", "GCN4_N16I_L19N"="MKQLEDKVEELLSKIYHNENEVARLKKLV") GCN4mReg <- rep("abcdefgabcdefgabcdefgabcdefga", 2) ## predict oligomerization GCN4mut <- predict(PrOCoilModel, GCN4mSeq, GCN4mReg) ## overlay plot of the two profiles plot(GCN4mut)
Function for predicting the oligomerization of one or multiple coiled coil segments
## S4 method for signature 'CCModel' predict(object, seq, reg)## S4 method for signature 'CCModel' predict(object, seq, reg)
object |
The model to be considered; can either be one of the
models included in the package ( |
seq |
One or several amino acid sequences; valid
characters are all uppercase letters except ‘B’,
‘J’, ‘O’, ‘U’, ‘X’, and
‘Z’; invalid characters are tolerated, but ignored
by the prediction. This argument can be a character vector,
an |
reg |
a character vector containing the heptad register(s); valid characters are the lowercase letters ‘a’-‘g’ and dashes ‘-’. Can also be omitted, see details below. |
The function predict is the most important one in the
procoil package. It is used to apply a coiled coil
prediction model to coiled coil sequences/segments. It uses the
discriminant function described in CCModel.
By default the final classification is computed on the basis of
the discriminant function value . If ,
the sequence is predicted as trimer, otherwise as dimer.
If the reg argument is missing, predict
looks whether the object passed as argument seq
includes heptad register information, either as an attribute
reg (if seq is a character vector), as
metadata field reg (if seq is an
AAString or AAStringSet
object), or via annotation metadata (if seq is
an AAStringSet or AAVector
object; see annotationMetadata).
In any case, the reg argument has priority over all other
ways of specifying the heptad annotation. In other words,
if reg is specified and seq contains heptad
annotations in one of the ways described above, the
reg argument has priority and the heptad annotation in
seq is ignored.
The reg argument must have exactly as many elements
as seq has sequences, and the registers must be
aligned to the sequences, i.e. the first register must be
exactly as long as the first sequence, and so on.
If heptad registers contain dashes, the predict
function extracts all contiguous coiled coil segments and computes
predictions for all of them. The returned
CCProfile object then contains
profiles/predictions of all coiled coil segments that were
extracted from seq (see example below).
returns a CCProfile object
Ulrich Bodenhofer
https://github.com/UBod/procoil/
Mahrenholz, C.C., Abfalter, I.G., Bodenhofer, U., Volkmer, R., and Hochreiter, S. (2011) Complex networks govern coiled coil oligomerization - predicting and profiling by means of a machine learning approach. Mol. Cell. Proteomics 10(5):M110.004994. DOI: doi:10.1074/mcp.M110.004994.
## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## show result GCN4wt ## example with four GCN4 mutations GCN4mSeq <- c("GCN4wt" ="MKQLEDKVEELLSKNYHLENEVARLKKLV", "GCN4_N16Y_L19T"="MKQLEDKVEELLSKYYHTENEVARLKKLV", "GCN4_E22R_K27E"="MKQLEDKVEELLSKNYHLENRVARLEKLV", "GCN4_V23K_K27E"="MKQLEDKVEELLSKNYHLENEKARLEKLV") ## to illustrate the alternative interface, we convert this ## character vector to an 'AAStringSet' object and add ## heptad registers as annotation metadata GCN4mAA <- AAStringSet(GCN4mSeq) annotationMetadata(GCN4mAA, annCharset="abcdefg") <- rep("abcdefgabcdefgabcdefgabcdefga", 4) ## predict oligomerization (note: no 'reg' argument!) GCN4mut <- predict(PrOCoilModel, GCN4mAA) ## display summary of result GCN4mut ## predict oligomerization of unknown sequence (Marcoil example) MarcoilEx <- predict(PrOCoilModel, "MGECDQLLVFMITSRVLVLSTLIIMDSRQVYLENLRQFAENLRQNIENVHSFLENLRADLENLRQKFPGKWYSAMPGRHG", "-------------------------------abcdefgabcdefgabcdefgabcdefgabcdefg--------------") ## show results MarcoilEx## predict oligomerization of GCN4 wildtype GCN4wt <- predict(PrOCoilModel, "MKQLEDKVEELLSKNYHLENEVARLKKLV", "abcdefgabcdefgabcdefgabcdefga") ## show result GCN4wt ## example with four GCN4 mutations GCN4mSeq <- c("GCN4wt" ="MKQLEDKVEELLSKNYHLENEVARLKKLV", "GCN4_N16Y_L19T"="MKQLEDKVEELLSKYYHTENEVARLKKLV", "GCN4_E22R_K27E"="MKQLEDKVEELLSKNYHLENRVARLEKLV", "GCN4_V23K_K27E"="MKQLEDKVEELLSKNYHLENEKARLEKLV") ## to illustrate the alternative interface, we convert this ## character vector to an 'AAStringSet' object and add ## heptad registers as annotation metadata GCN4mAA <- AAStringSet(GCN4mSeq) annotationMetadata(GCN4mAA, annCharset="abcdefg") <- rep("abcdefgabcdefgabcdefgabcdefga", 4) ## predict oligomerization (note: no 'reg' argument!) GCN4mut <- predict(PrOCoilModel, GCN4mAA) ## display summary of result GCN4mut ## predict oligomerization of unknown sequence (Marcoil example) MarcoilEx <- predict(PrOCoilModel, "MGECDQLLVFMITSRVLVLSTLIIMDSRQVYLENLRQFAENLRQNIENVHSFLENLRADLENLRQKFPGKWYSAMPGRHG", "-------------------------------abcdefgabcdefgabcdefgabcdefgabcdefg--------------") ## show results MarcoilEx